Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSSTR2
LigandBDBM81767
Substrate/Competitorn/a
Ki 0.28±n/a nM
CommentsPDSP_1735
Citation Raynor KMurphy WACoy DHTaylor JEMoreau JPYasuda KBell GIReisine T Cloned somatostatin receptors: identification of subtype-selective peptides and demonstration of high affinity binding of linear peptides. Mol Pharmacol 43:838-44 (1993) [PubMed]
More Info.:Get all data from this article
 
SSTR2
Name:Somatostatin receptor
Synonyms:SOMATOSTATIN SST2 | Somatostatin receptor | Somatostatin receptor 2 | Somatostatin receptor type 2
Type:Enzyme Catalytic Domain
Mol. Mass.:41234.26
Organism:MOUSE
Description:SOMATOSTATIN SST2 SSTR2 MOUSE::P30875
Residue:369
Sequence:
MEMSSEQLNGSQVWVSSPFDLNGSLGPSNGSNQTEPYYDMTSNAVLTFIYFVVCVVGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWCVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVIL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTEDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81767
n/a
NameBDBM81767
Synonyms:15-28-Somatostatin-28 | CAS_38916-34-6 | CB6417646 | Somatostatin-14
TypeSmall organic molecule
Emp. Form.C76H104N18O19S2
Mol. Mass.1637.878
SMILESC[C@@H](O)[C@@H]1NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CO)NC1=O)C(O)=O)NC(=O)CNC(=O)[C@H](C)N)[C@@H](C)O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: