Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSSTR3
LigandBDBM84628
Substrate/Competitorn/a
Ki 20±n/a nM
CommentsPDSP_775
Citation Raynor KMurphy WACoy DHTaylor JEMoreau JPYasuda KBell GIReisine T Cloned somatostatin receptors: identification of subtype-selective peptides and demonstration of high affinity binding of linear peptides. Mol Pharmacol 43:838-44 (1993) [PubMed]
More Info.:Get all data from this article
 
SSTR3
Name:SSTR3
Synonyms:SOMATOSTATIN SST3 | SS3R | SSR-28 | Somatostatin receptor | Somatostatin receptor 3 | Somatostatin receptor type 3
Type:Enzyme Catalytic Domain
Mol. Mass.:47225.49
Organism:MOUSE
Description:SOMATOSTATIN SST3 SSTR3 MOUSE::P30935
Residue:428
Sequence:
MATVTYPSSEPTTLDPGNASSTWPLDTTLGNTSAGASLTGLAVSGILISLVYLVVCVVGL
LGNSLVIYVVLRHTSSPSVTSVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLV
MAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVV
VFSGVPRGMSTCHMQWPEPAAAWRTAFIIYTAALGFFGPLLVICLCYLLIVVKVRSTTRR
VRAPSCQWVQAPACQRRRRSERRVTRMVVAVVALFVLCWMPFYLLNIVNVVCPLPEEPAF
FGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRILLRPSRRIRSQEPGSGPPEKTEEE
EDEEEEERREEEERRMQRGQEMNGRLSQIAQAGTSGQQPRPCTGTAKEQQLLPQEATAGD
KASTLSHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM84628
n/a
NameBDBM84628
Synonyms:EC5-21
TypeSmall organic molecule
Emp. Form.C56H66N10O8S2
Mol. Mass.1071.315
SMILESCC(O)C1NC(=O)C(CCCCN)NC(=O)C(Cc2c[nH]c3ccccc23)NC(=O)C(Cc2ccccc2)NC(=O)C(CSSCC(NC1=O)C(=O)NCc1cccc2ccccc12)NC(=O)C(N)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: