Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSSTR3
LigandBDBM82457
Substrate/Competitorn/a
Ki 0.08±n/a nM
CommentsPDSP_1032
Citation Raynor KMurphy WACoy DHTaylor JEMoreau JPYasuda KBell GIReisine T Cloned somatostatin receptors: identification of subtype-selective peptides and demonstration of high affinity binding of linear peptides. Mol Pharmacol 43:838-44 (1993) [PubMed]
More Info.:Get all data from this article
 
SSTR3
Name:SSTR3
Synonyms:SOMATOSTATIN SST3 | SS3R | SSR-28 | Somatostatin receptor | Somatostatin receptor 3 | Somatostatin receptor type 3
Type:Enzyme Catalytic Domain
Mol. Mass.:47225.49
Organism:MOUSE
Description:SOMATOSTATIN SST3 SSTR3 MOUSE::P30935
Residue:428
Sequence:
MATVTYPSSEPTTLDPGNASSTWPLDTTLGNTSAGASLTGLAVSGILISLVYLVVCVVGL
LGNSLVIYVVLRHTSSPSVTSVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLV
MAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVV
VFSGVPRGMSTCHMQWPEPAAAWRTAFIIYTAALGFFGPLLVICLCYLLIVVKVRSTTRR
VRAPSCQWVQAPACQRRRRSERRVTRMVVAVVALFVLCWMPFYLLNIVNVVCPLPEEPAF
FGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRILLRPSRRIRSQEPGSGPPEKTEEE
EDEEEEERREEEERRMQRGQEMNGRLSQIAQAGTSGQQPRPCTGTAKEQQLLPQEATAGD
KASTLSHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82457
n/a
NameBDBM82457
Synonyms:(1R,4S,7S,10R,13S,16R)-4-[(R)-1-Hydroxyethyl]-7-(4-aminobutyl)-10-(1H-indole-3-ylmethyl)-13-benzyl-28,29-dithia-2,5,8,11,14,17,25-heptaazabicyclo[14.10.4]triacontane-3,6,9,12,15,18,26-heptone | L-362,823
TypeSmall organic molecule
Emp. Form.C43H59N9O8S2
Mol. Mass.894.114
SMILESC[C@@H](O)[C@@H]1NC(=O)[C@H](CCCCN)NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H]2CSSC[C@H](NC1=O)C(=O)NCCCCCCC(=O)N2
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: