Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSSTR4
LigandBDBM82463
Substrate/Competitorn/a
Ki 0.005±n/a nM
CommentsPDSP_1033
Citation Raynor KO'Carroll AMKong HYasuda KMahan LCBell GIReisine T Characterization of cloned somatostatin receptors SSTR4 and SSTR5. Mol Pharmacol 44:385-92 (1993) [PubMed]
More Info.:Get all data from this article
 
SSTR4
Name:Somatostatin receptor
Synonyms:SOMATOSTATIN SST4 | Somatostatin receptor type 4
Type:Enzyme Catalytic Domain
Mol. Mass.:42096.84
Organism:RAT
Description:SOMATOSTATIN SST4 SSTR4 RAT::P30937
Residue:384
Sequence:
MNTPATLPLGGEDTTWTPGINASWAPDEEEDAVRSDGTGTAGMVTIQCIYALVCLVGLVG
NALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASAAALRHWPFGAVLCRAVLS
VDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLPIAVF
ADTRPARGGEAVACNLHWPHPAWSAVFVIYTFLLGFLLPVLAIGLCYLLIVGKMRAVALR
AGWQQRRRSEKKITRLVLMVVTVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILSYANS
CANPILYGFLSDNFRRSFQRVLCLRCCLLETTGGAEEEPLDYYATALKSRGGPGCICPPL
PCQQEPMQAEPACKRVPFTKTTTF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82463
n/a
NameBDBM82463
Synonyms:Cyclo[L-Trp-D-Trp-L-Lys-L-Thr-L-Phe-(7-amino*heptanoyl-L-Phe-)] | L-362,855 | L-362855
TypeSmall organic molecule
Emp. Form.C57H70N10O8
Mol. Mass.1023.2279
SMILESC[C@@H](O)[C@@H]1NC(=O)[C@H](CCCCN)NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2ccccc2)NC(=O)CCCCCCNC(=O)[C@H](Cc2ccccc2)NC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: