Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 5
LigandBDBM84626
Substrate/Competitorn/a
Ki 252±n/a nM
CommentsPDSP_377
Citation Raynor KO'Carroll AMKong HYasuda KMahan LCBell GIReisine T Characterization of cloned somatostatin receptors SSTR4 and SSTR5. Mol Pharmacol 44:385-92 (1993) [PubMed]
More Info.:Get all data from this article
 
Somatostatin receptor type 5
Name:Somatostatin receptor type 5
Synonyms:SOMATOSTATIN SST5 | SS-5-R | SS5-R | SS5R | Somatostatin receptor type 5 (SSTR5)
Type:Enzyme
Mol. Mass.:39218.02
Organism:Homo sapiens (Human)
Description:P35346
Residue:364
Sequence:
MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTL
VIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDG
VNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADV
QEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRR
RSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCAN
PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQ
TSKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM84626
n/a
NameBDBM84626
Synonyms:BIM 23034
TypeSmall organic molecule
Emp. Form.C55H64N10O8S2
Mol. Mass.1057.289
SMILESCC1NC(=O)C(CCCCN)NC(=O)C(Cc2c[nH]c3ccccc23)NC(=O)C(Cc2ccc(O)cc2)NC(=O)C(CSSCC(NC1=O)C(=O)NCc1cccc2ccccc12)NC(=O)C(N)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: