Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR6
LigandBDBM21393
Substrate/Competitorn/a
Ki 251.18±n/a nM
CommentsPDSP_205
Citation Plassat JLAmlaiky NHen R Molecular cloning of a mammalian serotonin receptor that activates adenylate cyclase. Mol Pharmacol 44:229-36 (1993) [PubMed]  Article
More Info.:Get all data from this article
 
HTR6
Name:HTR6
Synonyms:5-HT6 | 5-hydroxytryptamine receptor 6
Type:Enzyme Catalytic Domain
Mol. Mass.:47012.98
Organism:MOUSE
Description:5-HT6 HTR6 MOUSE::Q9R1C8
Residue:440
Sequence:
MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLLLGWHELGKARTSAPGQC
RLLASLPYVLVASGVTFFLPSGAICFTYCRILLAARKQAVQVASLTTGTATAGQALETLQ
VPRTPRPGMESADSRRLTTKHSRKALKASLTLGILLSMFFVTWLPFFVASIAQAVCDCIS
PGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFVPCVHCPPEHRASPASPSMWTSHS
GARPGLSLQQVLPLPLPPNSDSDSASGGTSGLQLTAQLLLPGEATRDPPPPTRAPTVVNF
FVTDSVEPEIRQHPLGSPMN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21393
n/a
NameBDBM21393
Synonyms:7-(dipropylamino)-5,6,7,8-tetrahydronaphthalen-1-ol | 8-Hydroxy-2-(di-n-propylamino)tetralin | 8-OH-DPAT | 8-OH-DPAT,(+) | 8-OH-DPAT,(-) | 8-hydroxy-N,N-dipropylaminotetralin | CHEMBL1788118 | CHEMBL505765 | CHEMBL56 | DPAT | [3H]-8-OH-DPAT | cid_1220
Typeradiolabeled ligand
Emp. Form.C16H25NO
Mol. Mass.247.3758
SMILESCCCN(CCC)C1CCc2cccc(O)c2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: