Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR6
LigandBDBM50130269
Substrate/Competitorn/a
Ki 10±n/a nM
CommentsPDSP_1095
Citation Plassat JLAmlaiky NHen R Molecular cloning of a mammalian serotonin receptor that activates adenylate cyclase. Mol Pharmacol 44:229-36 (1993) [PubMed]  Article
More Info.:Get all data from this article
 
HTR6
Name:HTR6
Synonyms:5-HT6 | 5-hydroxytryptamine receptor 6
Type:Enzyme Catalytic Domain
Mol. Mass.:47012.98
Organism:MOUSE
Description:5-HT6 HTR6 MOUSE::Q9R1C8
Residue:440
Sequence:
MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLLLGWHELGKARTSAPGQC
RLLASLPYVLVASGVTFFLPSGAICFTYCRILLAARKQAVQVASLTTGTATAGQALETLQ
VPRTPRPGMESADSRRLTTKHSRKALKASLTLGILLSMFFVTWLPFFVASIAQAVCDCIS
PGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFVPCVHCPPEHRASPASPSMWTSHS
GARPGLSLQQVLPLPLPPNSDSDSASGGTSGLQLTAQLLLPGEATRDPPPPTRAPTVVNF
FVTDSVEPEIRQHPLGSPMN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50130269
n/a
NameBDBM50130269
Synonyms:(6aR,9R)-5-Bromo-7-methyl-4,6,6a,7,8,9-hexahydro-indolo[4,3-fg]quinoline-9-carboxylic acid diethylamide | 5-Bromo-7-methyl-4,6,6a,7,8,9-hexahydro-indolo[4,3-fg]quinoline-9-carboxylic acid diethylamide | CHEMBL274384 | LSD,2-Bromo
TypeSmall organic molecule
Emp. Form.C20H24BrN3O
Mol. Mass.402.328
SMILESCCN(CC)C(=O)[C@H]1CN(C)[C@@H]2Cc3c(Br)[nH]c4cccc(C2=C1)c34 |c:23|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: