Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSnake venom metalloproteinase Bap1
LigandBDBM50239116
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1665239
IC50 20±n/a nM
Citation Villalta-Romero FBorro LMandic BEscalante TRucavado AGutiérrez JMNeshich GTasic L Discovery of small molecule inhibitors for the snake venom metalloprotease BaP1 using in silico and in vitro tests. Bioorg Med Chem Lett 27:2018-2022 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Snake venom metalloproteinase Bap1
Name:Snake venom metalloproteinase Bap1
Synonyms:Bap-1 | Hemorrhagic metalloproteinase BaP1 | SVMP
Type:PROTEIN
Mol. Mass.:45929.07
Organism:Bothrops asper
Description:ChEMBL_840308
Residue:408
Sequence:
MIEVLLVTICLAVFPYQGSSIILESGNVNDYEVVYPRKVTELPKGAVQPKYEDAMQYEFK
VNGEPVVLHLEKNKGLFSEDYSETHYSPDGRKIITYPSFEDHCYYHGRIENDADSTASIS
ACNGLKGHFKLQGETYLIEPLKLSDSEAHAVYKYENVEKEDEAPKMCGVTETNWESYEPI
KKASQSNLTPEQQRFSPRYIELAVVADHGIFTKYNSNLNTIRTRVHEMLNTVNGFYRSVD
VHAPLANLEVWSKQDLIKVQKDSSKTLKSFGEWRERDLLPRISHDHAQLLTAVVFDGNTI
GRAYTGGMCDPRHSVGVVRDHSKNNLWVAVTMAHELGHNLGIHHDTGSCSCGAKSCIMAS
VLSKVLSYEFSDCSQNQYETYLTNHNPQCILNKPLLTVSGNELLEAGE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50239116
n/a
NameBDBM50239116
Synonyms:CHEMBL4098534
TypeSmall organic molecule
Emp. Form.C13H12N4O5
Mol. Mass.304.2582
SMILESCc1ccc(OCC(=O)N\N=C2/C(=O)NC(=O)N=C2O)cc1 |c:17|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: