Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase XIV
LigandBDBM50239279
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1665872
Ki 3.2±n/a nM
Citation Bruno EBuemi MRDi Fiore ADe Luca LFerro SAngeli ACirilli RSadutto DAlterio VMonti SMSupuran CTDe Simone GGitto R Probing Molecular Interactions between Human Carbonic Anhydrases (hCAs) and a Novel Class of Benzenesulfonamides. J Med Chem 60:4316-4326 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase XIV
Name:Carbonic Anhydrase XIV
Synonyms:CA-XIV | Carbonate dehydratase XIV | Carbonic anhydrase 14 | Carbonic anhydrase 14 (CA XIV) | Carbonic anhydrase XIV (CA XIV)
Type:Enzyme
Mol. Mass.:37665.67
Organism:Homo sapiens (Human)
Description:Human (cloned) isozyme.
Residue:337
Sequence:
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPD
LPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGG
SEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSH
LHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQ
LEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVG
CLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50239279
n/a
NameBDBM50239279
Synonyms:CHEMBL4070634
TypeSmall organic molecule
Emp. Form.C23H22N2O4S
Mol. Mass.422.497
SMILESCOc1ccc2C(N(CCc2c1)C(=O)c1ccc(cc1)S(N)(=O)=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: