Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-1 receptor-associated kinase 4
LigandBDBM50239504
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1666148
IC50 5.9±n/a nM
Citation Lee KLAmbler CMAnderson DRBoscoe BPBree AGBrodfuehrer JIChang JSChoi CChung SCurran KJDay JEDehnhardt CMDower KDrozda SEFrisbie RKGavrin LKGoldberg JAHan SHegen MHepworth DHope HRKamtekar SKilty ICLee ALin LLLovering FELowe MDMathias JPMorgan HMMurphy EAPapaioannou NPatny APierce BSRao VRSaiah ESamardjiev IJSamas BMShen MWHShin JHSoutter HHStrohbach JWSymanowicz PTThomason JRTrzupek JDVargas RVincent FYan JZapf CWWright SW Discovery of Clinical Candidate 1-{[(2S,3S,4S)-3-Ethyl-4-fluoro-5-oxopyrrolidin-2-yl]methoxy}-7-methoxyisoquinoline-6-carboxamide (PF-06650833), a Potent, Selective Inhibitor of Interleukin-1 Receptor Associated Kinase 4 (IRAK4), by Fragment-Based Drug Design. J Med Chem 60:5521-5542 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Interleukin-1 receptor-associated kinase 4
Name:Interleukin-1 receptor-associated kinase 4
Synonyms:IRAK-4 | Interleukin-1 receptor-associated kinase 4 (IRAK-4) | Interleukin-1 receptor-associated kinase 4 (IRAK4) | Renal carcinoma antigen NY-REN-64
Type:Protein
Mol. Mass.:51519.08
Organism:Homo sapiens (Human)
Description:Q9NWZ3
Residue:460
Sequence:
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITV
QQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNF
DERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN
FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50239504
n/a
NameBDBM50239504
Synonyms:CHEMBL4061890
TypeSmall organic molecule
Emp. Form.C16H17N3O4
Mol. Mass.315.3239
SMILESCOc1cc2c(OC[C@@H]3CCC(=O)N3)ccnc2cc1C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: