Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
LigandBDBM50239718
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1666828
IC50 5.1±n/a nM
Citation Liu QShi QMarcoux DBatt DGCornelius LQin LYRuan ZNeels JBeaudoin-Bertrand MSrivastava ASLi LCherney RJGong HWatterson SHWeigelt CGillooly KMMcIntyre KWXie JHObermeier MTFura ASleczka BStefanski KFancher RMPadmanabhan SRp TKundu IRajareddy KSmith RHennan JKXing DFan JLevesque PCRuan QPitt SZhang RPedicord DPan JYarde MLu HLippy JGoldstine CSkala SRampulla RAMathur AGupta AArunachalam PNSack JSMuckelbauer JKCvijic MESalter-Cid LMBhide RSPoss MAHynes JCarter PHMacor JERuepp SSchieven GLTino JA Identification of a Potent, Selective, and Efficacious Phosphatidylinositol 3-Kinase? (PI3K?) Inhibitor for the Treatment of Immunological Disorders. J Med Chem 60:5193-5208 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
Name:Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
Synonyms:PI3-kinase subunit delta | PI3K-delta | PI3Kdelta | Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta | Pik3cd | PtdIns-3-kinase subunit delta | PtdIns-3-kinase subunit p110-delta | p110delta
Type:Enzyme
Mol. Mass.:119725.20
Organism:Mus musculus (Mouse)
Description:O35904
Residue:1043
Sequence:
MPPGVDCPMEFWTKEESQSVVVDFLLPTGVYLNFPVSRNANLSTIKQVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPSARGWRA
GLLRVSNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQPLVEQPEEYA
LQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
AKPPPIPAKKPSSVSLWSLEQPFSIELIEGRKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPAGTVRGNPNTESAAALVIYLPEVAP
HPVYFPALEKILELGRHGERGRITEEELQLREILERRGSGELYEHEKDLVWKMRHEVQEH
FPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLR
KLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVA
LRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQ
ETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNG
DDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNK
SNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMI
RESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCE
RAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNE
ALRESWKTKVNWLAHNVSKDNRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50239718
n/a
NameBDBM50239718
Synonyms:CHEMBL4064666 | US10214537, Example 639
TypeSmall organic molecule
Emp. Form.C22H20F3N7O2
Mol. Mass.471.4351
SMILESCC(=O)N1CCN(C(=O)C1(C)C)c1cc(ccc1C#N)-c1cc(c2c(N)ncnn12)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: