Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 1
LigandBDBM50239858
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1667343
IC50 43±n/a nM
Citation Stenzel KHamacher AHansen FKGertzen CGWSenger JMarquardt VMarek LMarek MRomier CRemke MJung MGohlke HKassack MUKurz T Alkoxyurea-Based Histone Deacetylase Inhibitors Increase Cisplatin Potency in Chemoresistant Cancer Cell Lines. J Med Chem 60:5334-5348 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 1
Name:Histone deacetylase 1
Synonyms:HD1 | Histone deacetylase 1 (HDAC1) | Human HDAC1 | RPD3L1
Type:Enzyme
Mol. Mass.:55090.27
Organism:Homo sapiens (Human)
Description:Q13547
Residue:482
Sequence:
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50239858
n/a
NameBDBM50239858
Synonyms:CHEMBL4067006
TypeSmall organic molecule
Emp. Form.C19H26N4O6
Mol. Mass.406.4329
SMILESCOc1cc(NC(=O)NOCCCCCC(=O)NO)c2nc(OC)cc(C)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: