| Reaction Details |
|---|
 | Report a problem with these data |
| Target | P2Y purinoceptor 12 |
|---|
| Ligand | BDBM50000877 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_162869 |
|---|
| EC50 | 60±n/a nM |
|---|
| Citation |  Meanwell, NA; Pearce, BC; Roth, HR; Smith, EC; Wedding, DL; Wright, JJ; Buchanan, JO; Baryla, UM; Gamberdella, M; Gillespie, E Inhibitors of blood platelet cAMP phosphodiesterase. 2. Structure-activity relationships associated with 1,3-dihydro-2H-imidazo[4,5-b]quinolin-2-ones substituted with functionalized side chains. J Med Chem35:2672-87 (1992) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| P2Y purinoceptor 12 |
|---|
| Name: | P2Y purinoceptor 12 |
|---|
| Synonyms: | ADP-glucose receptor | ADPG-R | HORK3 | P2RY12 | P2T(AC) | P2Y purinoceptor 12 | P2Y(AC) | P2Y(ADP) | P2Y(cyc) | P2Y12 | P2Y12 platelet ADP receptor | P2Y12_HUMAN | Purinergic receptor P2Y12 | SP1999 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39458.48 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9H244 |
|---|
| Residue: | 342 |
|---|
| Sequence: | MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFI
IFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITI
DRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKS
EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI
IIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFF
LCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
|
|
|
|---|
| BDBM50000877 |
|---|
| n/a |
|---|
| Name | BDBM50000877 |
|---|
| Synonyms: | CHEMBL88955 | N-Cycloheptyl-N-methyl-4-(2-oxo-2,3-dihydro-1H-imidazo[4,5-b]quinolin-7-yloxy)-butyramide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H28N4O3 |
|---|
| Mol. Mass. | 396.4827 |
|---|
| SMILES | CN(C1CCCCCC1)C(=O)CCCOc1ccc2nc3[nH]c(=O)[nH]c3cc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
