Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M4
LigandBDBM50240539
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1668370
IC50 117±n/a nM
Citation Bender AMWeiner RLLuscombe VBCho HPNiswender CMEngers DWBridges TMConn PJLindsley CW Synthesis and evaluation of 4,6-disubstituted pyrimidines as CNS penetrant pan-muscarinic antagonists with a novel chemotype. Bioorg Med Chem Lett 27:2479-2483 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M4
Name:Muscarinic acetylcholine receptor M2 and M4
Synonyms:CHRM4 | Cholinergic, muscarinic M4 | Muscarinic acetylcholine receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:53079.31
Organism:Homo sapiens (Human)
Description:Cholinergic, muscarinic M4 CHRM4 HUMAN M3::P08173
Residue:479
Sequence:
MANFTPVNGSSGNQSVRLVTSSSHNRYETVEMVFIATVTGSLSLVTVVGNILVMLSIKVN
RQLQTVNNYFLFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLALDYVVSNASV
MNLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTV
PDNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAK
TLAFLKSPLMKQSVKKPPPGEAAREELRNGKLEEAPPPALPPPPRPVADKDTSNESSSGS
ATQNTKERPATELSTTEATTPAMPAPPLQPRALNPASRWSKIQIVTKQTGNECVTAIEIV
PATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMV
LVNTFCQSCIPDTVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50240539
n/a
NameBDBM50240539
Synonyms:CHEMBL4103428
TypeSmall organic molecule
Emp. Form.C25H24ClFN4O2
Mol. Mass.466.935
SMILESFc1cc(Cl)ccc1Oc1cc(ncn1)N1CCC(CC1)C(=O)N1CCc2ccccc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: