Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKetohexokinase
LigandBDBM50241178
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1669645
IC50 340±n/a nM
Citation Huard KAhn KAmor PBeebe DABorzilleri KAChrunyk BACoffey SBCong YConn ELCulp JSDowling MSGorgoglione MFGutierrez JAKnafels JDLachapelle EAPandit JParris KDPerez SPfefferkorn JAPrice DARaymer BRoss TTShavnya ASmith ACSubashi TATesz GJThuma BATu MWeaver JDWeng YWithka JMXing GMagee TV Discovery of Fragment-Derived Small Molecules for in Vivo Inhibition of Ketohexokinase (KHK). J Med Chem 60:7835-7849 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ketohexokinase
Name:Ketohexokinase
Synonyms:2.7.1.3 | Hepatic fructokinase | Ketohexokinase | Khk
Type:PROTEIN
Mol. Mass.:32749.44
Organism:Rattus norvegicus
Description:ChEMBL_117528
Residue:298
Sequence:
MEEKQILCVGLVVLDIINVVDKYPEEDTDRRCLSQRWQRGGNASNSCTVLSLLGARCAFM
GSLAHGHVADFLVADFRRRGVDVSQVAWQSQGDTPCSCCIVNNSNGSRTIILYDTNLPDV
SAKDFEKVDLTRFKWIHIEGRNASEQVKMLQRIEQYNATQPLQQKVRVSVEIEKPREELF
QLFGYGEVVFVSKDVAKHLGFRSAGEALKGLYSRVKKGATLICAWAEEGADALGPDGQLL
HSDAFPPPRVVDTLGAGDTFNASVIFSLSKGNSMQEALRFGCQVAGKKCGLQGFDGIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50241178
n/a
NameBDBM50241178
Synonyms:CHEMBL4070442
TypeSmall organic molecule
Emp. Form.C16H19F3N4O3
Mol. Mass.372.3423
SMILESC[C@]1(O)CCN(C1)c1nc(cc(c1C#N)C(F)(F)F)N1C[C@H](O)[C@@H](O)C1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: