| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Ligand | BDBM50035880 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1670159 (CHEMBL4020047) |
|---|
| IC50 | 170±n/a nM |
|---|
| Citation |  Rudling, A; Gustafsson, R; Almlöf, I; Homan, E; Scobie, M; Warpman Berglund, U; Helleday, T; Stenmark, P; Carlsson, J Fragment-Based Discovery and Optimization of Enzyme Inhibitors by Docking of Commercial Chemical Space. J Med Chem60:8160-8169 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Name: | Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Synonyms: | 7,8-dihydro-8-oxoguanine triphosphatase | 8ODP_HUMAN | MTH1 | MutT homolog 1 protein (MTH1) | NUDT1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 22514.81 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P36639 |
|---|
| Residue: | 197 |
|---|
| Sequence: | MYWSNQITRRLGERVQGFMSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVL
LGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPE
LMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKF
QGQDTILDYTLREVDTV
|
|
|
|---|
| BDBM50035880 |
|---|
| n/a |
|---|
| Name | BDBM50035880 |
|---|
| Synonyms: | CHEMBL1437990 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H13N5S |
|---|
| Mol. Mass. | 271.341 |
|---|
| SMILES | Nc1nc(SCCc2ccccc2)c2nc[nH]c2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
