Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKappa-type opioid receptor
LigandBDBM50002182
Substrate/Competitorn/a
Meas. Tech.ChEBML_145346
Ki 0.006700±n/a nM
Citation Snyder KRStory SCHeidt MEMurray TFDeLander GEAldrich JV Effect of modification of the basic residues of dynorphin A-(1-13) amide on kappa opioid receptor selectivity and opioid activity. J Med Chem 35:4330-3 (1992) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Kappa-type opioid receptor
Name:Kappa-type opioid receptor
Synonyms:Kappa Opioid Receptor | OPIATE Kappa | Opiate Kappa 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42744.99
Organism:Cavia porcellus (domestic guinea pig)
Description:P41144
Residue:380
Sequence:
MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRV
RNTVQDPAYMRNVDGVNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002182
n/a
NameBDBM50002182
Synonyms:CHEMBL415617 | Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Lys-Pro-Lys-Leu-Lys
TypeSmall organic molecule
Emp. Form.C75H127N23O14
Mol. Mass.1574.9566
SMILESCC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)CNC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: