Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2 and M4
LigandBDBM10759
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1676741
Ki 380±n/a nM
Citation Fish IStößel AEitel KValant CAlbold SHuebner HMöller DClark MJSunahara RKChristopoulos AShoichet BKGmeiner P Structure-Based Design and Discovery of New M J Med Chem 60:9239-9250 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M2 and M4
Name:Muscarinic acetylcholine receptor M2 and M5
Synonyms:CHRM2 | Cholinergic, muscarinic M2 | RecName: Full=Muscarinic acetylcholine receptor M2
Type:GPCR
Mol. Mass.:51730.61
Organism:Homo sapiens (Human)
Description:P08172
Residue:466
Sequence:
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10759
n/a
NameBDBM10759
Synonyms:2-acetoxyethyl(trimethyl)ammonium;bromide | 2-acetoxyethyl(trimethyl)ammonium;perchlorate | CHEMBL667 | [2-(acetyloxy)ethyl]trimethylazanium | acetylcholine | acetylcholine chloride | cid_6060
TypeSmall Organic Molecule
Emp. Form.C7H16NO2
Mol. Mass.146.2069
SMILESCC(=O)OCC[N+](C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: