| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Type-1 angiotensin II receptor B |
|---|
| Ligand | BDBM50003155 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_34834 |
|---|
| Ki | 3.1±n/a nM |
|---|
| Citation |  De, B; Winn, M; Zydowsky, TM; Kerkman, DJ; DeBernardis, JF; Lee, J; Buckner, S; Warner, R; Brune, M; Hancock, A Discovery of a novel class of orally active, non-peptide angiotensin II antagonists. J Med Chem35:3714-7 (1992) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Type-1 angiotensin II receptor B |
|---|
| Name: | Type-1 angiotensin II receptor B |
|---|
| Synonyms: | AGTRB_RAT | AT3 | Agtr1 | Agtr1b | Angiotensin II AT1B | Angiotensin II receptor (AT-1) type-1 | Angiotensin II type 1b (AT-1b) receptor | At1b | Type-1B angiotensin II receptor |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 40929.44 |
|---|
| Organism: | RAT |
|---|
| Description: | Angiotensin II AT1B 0 RAT::P29089 |
|---|
| Residue: | 359 |
|---|
| Sequence: | MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFR
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE
|
|
|
|---|
| BDBM50003155 |
|---|
| n/a |
|---|
| Name | BDBM50003155 |
|---|
| Synonyms: | 4-{Butyl-[2''-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-amino}-pyrimidine-5-carboxylic acid | 4-{Butyl-[2'-(1H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-amino}-pyrimidine-5-carboxylic acid;5Hydro chloride | CHEMBL1237157 | CHEMBL333534 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H23N7O2 |
|---|
| Mol. Mass. | 429.4744 |
|---|
| SMILES | CCCCN(Cc1ccc(cc1)-c1ccccc1-c1nnn[nH]1)c1ncncc1C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
