Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M1
LigandBDBM50003359
Substrate/Competitorn/a
Meas. Tech.ChEBML_165078
IC50 0.008000±n/a nM
Citation Ward JSMerritt LKlimkowski VJLamb MLMitch CHBymaster FPSawyer BShannon HEOlesen PHHonoré T Novel functional M1 selective muscarinic agonists. 2. Synthesis and structure-activity relationships of 3-pyrazinyl-1,2,5,6-tetrahydro-1-methylpyridines. Construction of a molecular model for the M1 pharmacophore. J Med Chem 35:4011-9 (1992) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M1
Name:Muscarinic acetylcholine receptor M1 and M3
Synonyms:CHRM1 | Cholinergic receptor, muscarinic 1 | Cholinergic, muscarinic M1
Type:Protein
Mol. Mass.:51442.54
Organism:Homo sapiens (Human)
Description:P11229
Residue:460
Sequence:
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003359
n/a
NameBDBM50003359
Synonyms:5-(4-Hexyloxy-[1,2,5]thiadiazol-3-yl)-1-methyl-1,2,3,6-tetrahydro-pyridine; oxalic acid | 5-[4-(hexyloxy)-1,2,5-thiadiazol-3-yl]-1-methyl-1,2,3,6-tetrahydropyridine | CHEMBL21536 | CHEMBL73149 | LY 246708 | Xanomeline
TypeSmall organic molecule
Emp. Form.C14H23N3OS
Mol. Mass.281.417
SMILESCCCCCCOc1nsnc1C1=CCCN(C)C1 |t:13|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: