Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic receptor M1 and M2
LigandBDBM50003372
Substrate/Competitorn/a
Meas. Tech.ChEBML_138799
IC50 60±n/a nM
Citation Ward JSMerritt LKlimkowski VJLamb MLMitch CHBymaster FPSawyer BShannon HEOlesen PHHonoré T Novel functional M1 selective muscarinic agonists. 2. Synthesis and structure-activity relationships of 3-pyrazinyl-1,2,5,6-tetrahydro-1-methylpyridines. Construction of a molecular model for the M1 pharmacophore. J Med Chem 35:4011-9 (1992) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Muscarinic receptor M1 and M2
Name:Muscarinic receptor M1 and M2
Synonyms:Cholinergic, muscarinic M1 | Chrm-1 | Chrm1 | cholinergic receptor, muscarinic 1
Type:Enzyme Catalytic Domain
Mol. Mass.:51390.46
Organism:RAT
Description:Cholinergic, muscarinic M1 CHRM1 RAT::P08482
Residue:460
Sequence:
MNTSVPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPESPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDSEAQAPTKQPPKSSPNTVKRPTKKGRDRGGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTVNPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003372
n/a
NameBDBM50003372
Synonyms:CHEMBL308168 | Hexyl-[4-(1-methyl-1,2,5,6-tetrahydro-pyridin-3-yl)-[1,2,5]thiadiazol-3-yl]-amine
TypeSmall organic molecule
Emp. Form.C14H24N4S
Mol. Mass.280.432
SMILESCCCCCCNc1nsnc1C1=CCCN(C)C1 |t:13|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: