Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInduced myeloid leukemia cell differentiation protein Mcl-1
LigandBDBM50244130
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1673166
Ki 1.000000±n/a nM
Citation Shaw SBian ZZhao BTarr JCVeerasamy NJeon KOBelmar JArnold ALFogarty SAPerry ESensintaffar JLCamper DVRossanese OWLee TOlejniczak ETFesik SW Optimization of Potent and Selective Tricyclic Indole Diazepinone Myeloid Cell Leukemia-1 Inhibitors Using Structure-Based Design. J Med Chem 61:2410-2421 (2018) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Induced myeloid leukemia cell differentiation protein Mcl-1
Name:Induced myeloid leukemia cell differentiation protein Mcl-1
Synonyms:Bcl-2-like protein 3 | Bcl-2-like protein 3 (Mcl-1) | Bcl-2-related protein EAT/mcl1 | Bcl2-L-3 | Induced myeloid leukemia cell differentiation protein (Mcl-1) | Mcl-1 | Myeloid Cell factor-1 (Mcl-1) | Myeloid cell leukemia sequence 1 (BCL2-related) | mcl1/EAT
Type:Membrane; Single-pass membrane protein
Mol. Mass.:37332.87
Organism:Homo sapiens (Human)
Description:n/a
Residue:350
Sequence:
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50244130
n/a
NameBDBM50244130
Synonyms:CHEMBL4097235
TypeSmall organic molecule
Emp. Form.C35H35Cl2N5O4
Mol. Mass.660.59
SMILESCc1nn(C)c(C)c1-c1c(Cl)ccc2c(CCCOc3cc(C)c(Cl)c(C)c3)c3C(=O)N(CCCn3c12)c1cc(ccn1)C(O)=O |(40.39,-44.88,;38.93,-44.41,;38.45,-42.95,;36.91,-42.95,;36,-41.71,;36.44,-44.42,;34.97,-44.9,;37.69,-45.32,;37.69,-46.87,;36.37,-47.64,;35.03,-46.87,;36.36,-49.18,;37.7,-49.95,;39.03,-49.18,;40.51,-49.66,;40.98,-51.13,;42.49,-51.45,;42.96,-52.91,;44.47,-53.23,;44.95,-54.69,;46.45,-55.01,;46.93,-56.47,;48.43,-56.78,;45.9,-57.62,;46.37,-59.08,;44.39,-57.3,;43.36,-58.44,;43.91,-55.83,;41.42,-48.4,;42.97,-48.47,;43.58,-49.88,;43.99,-47.29,;43.7,-45.76,;42.34,-45.03,;40.91,-45.65,;40.5,-47.15,;39.03,-47.63,;45.48,-47.69,;45.87,-49.18,;47.35,-49.58,;48.44,-48.49,;48.04,-47,;46.56,-46.6,;47.75,-51.07,;49.23,-51.47,;46.65,-52.15,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: