Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInduced myeloid leukemia cell differentiation protein Mcl-1
LigandBDBM50244131
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1673166
Ki 2.4±n/a nM
Citation Shaw SBian ZZhao BTarr JCVeerasamy NJeon KOBelmar JArnold ALFogarty SAPerry ESensintaffar JLCamper DVRossanese OWLee TOlejniczak ETFesik SW Optimization of Potent and Selective Tricyclic Indole Diazepinone Myeloid Cell Leukemia-1 Inhibitors Using Structure-Based Design. J Med Chem 61:2410-2421 (2018) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Induced myeloid leukemia cell differentiation protein Mcl-1
Name:Induced myeloid leukemia cell differentiation protein Mcl-1
Synonyms:Bcl-2-like protein 3 | Bcl-2-like protein 3 (Mcl-1) | Bcl-2-related protein EAT/mcl1 | Bcl2-L-3 | Induced myeloid leukemia cell differentiation protein (Mcl-1) | Mcl-1 | Myeloid Cell factor-1 (Mcl-1) | Myeloid cell leukemia sequence 1 (BCL2-related) | mcl1/EAT
Type:Membrane; Single-pass membrane protein
Mol. Mass.:37332.87
Organism:Homo sapiens (Human)
Description:n/a
Residue:350
Sequence:
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50244131
n/a
NameBDBM50244131
Synonyms:CHEMBL4075756
TypeSmall organic molecule
Emp. Form.C35H35Cl2N5O4
Mol. Mass.660.59
SMILESCc1nn(C)c(C)c1-c1c(Cl)ccc2c(CCCOc3cc(C)c(Cl)c(C)c3)c3C(=O)N(CCCn3c12)c1ccc(cn1)C(O)=O |(73.64,-43.71,;72.18,-43.24,;71.7,-41.77,;70.16,-41.78,;69.25,-40.54,;69.69,-43.24,;68.22,-43.72,;70.93,-44.15,;70.94,-45.69,;69.61,-46.46,;68.28,-45.69,;69.61,-48.01,;70.95,-48.78,;72.28,-48.01,;73.75,-48.49,;74.23,-49.95,;75.74,-50.27,;76.21,-51.74,;77.72,-52.05,;78.2,-53.52,;79.7,-53.83,;80.18,-55.29,;81.68,-55.61,;79.14,-56.44,;79.62,-57.91,;77.64,-56.12,;76.61,-57.27,;77.16,-54.66,;74.66,-47.23,;76.22,-47.29,;76.83,-48.71,;77.24,-46.12,;76.95,-44.59,;75.58,-43.85,;74.16,-44.47,;73.75,-45.98,;72.28,-46.46,;78.73,-46.52,;79.8,-45.43,;81.29,-45.82,;81.69,-47.32,;80.6,-48.4,;79.11,-48,;83.18,-47.72,;84.27,-46.63,;83.58,-49.2,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: