Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInduced myeloid leukemia cell differentiation protein Mcl-1
LigandBDBM50244168
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1673169
Ki 0.700000±n/a nM
Citation Shaw SBian ZZhao BTarr JCVeerasamy NJeon KOBelmar JArnold ALFogarty SAPerry ESensintaffar JLCamper DVRossanese OWLee TOlejniczak ETFesik SW Optimization of Potent and Selective Tricyclic Indole Diazepinone Myeloid Cell Leukemia-1 Inhibitors Using Structure-Based Design. J Med Chem 61:2410-2421 (2018) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Induced myeloid leukemia cell differentiation protein Mcl-1
Name:Induced myeloid leukemia cell differentiation protein Mcl-1
Synonyms:Bcl-2-like protein 3 | Bcl-2-like protein 3 (Mcl-1) | Bcl-2-related protein EAT/mcl1 | Bcl2-L-3 | Induced myeloid leukemia cell differentiation protein (Mcl-1) | Mcl-1 | Myeloid Cell factor-1 (Mcl-1) | Myeloid cell leukemia sequence 1 (BCL2-related) | mcl1/EAT
Type:Membrane; Single-pass membrane protein
Mol. Mass.:37332.87
Organism:Homo sapiens (Human)
Description:n/a
Residue:350
Sequence:
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50244168
n/a
NameBDBM50244168
Synonyms:CHEMBL4073496
TypeSmall organic molecule
Emp. Form.C39H39Cl2N5O4
Mol. Mass.712.664
SMILESCc1nn(C)c(C)c1-c1c(Cl)ccc2c(CCCOc3cc(C)c(Cl)c(C)c3)c3C(=O)N(CCCn3c12)c1cc(C(O)=O)c2ccn(C)c2c1 |(8.69,-5.59,;7.22,-5.12,;6.74,-3.66,;5.2,-3.66,;4.29,-2.42,;4.73,-5.13,;3.26,-5.61,;5.98,-6.03,;5.98,-7.57,;4.66,-8.35,;3.32,-7.58,;4.65,-9.89,;5.99,-10.66,;7.32,-9.89,;8.8,-10.37,;9.27,-11.83,;10.78,-12.15,;11.25,-13.62,;12.76,-13.94,;13.24,-15.4,;14.74,-15.71,;15.22,-17.17,;16.73,-17.49,;14.19,-18.33,;14.66,-19.79,;12.68,-18.01,;11.65,-19.15,;12.2,-16.54,;9.71,-9.11,;11.26,-9.17,;11.87,-10.59,;12.28,-8,;11.99,-6.47,;10.63,-5.73,;9.2,-6.35,;8.8,-7.86,;7.32,-8.34,;13.77,-8.4,;14.85,-7.31,;16.33,-7.7,;17.42,-6.61,;17.02,-5.13,;18.91,-7.01,;16.73,-9.2,;18.1,-9.9,;17.85,-11.43,;16.33,-11.66,;15.63,-13.03,;15.64,-10.28,;14.16,-9.88,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: