Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInduced myeloid leukemia cell differentiation protein Mcl-1
LigandBDBM50244151
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1673170
Ki 1.6±n/a nM
Citation Shaw SBian ZZhao BTarr JCVeerasamy NJeon KOBelmar JArnold ALFogarty SAPerry ESensintaffar JLCamper DVRossanese OWLee TOlejniczak ETFesik SW Optimization of Potent and Selective Tricyclic Indole Diazepinone Myeloid Cell Leukemia-1 Inhibitors Using Structure-Based Design. J Med Chem 61:2410-2421 (2018) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Induced myeloid leukemia cell differentiation protein Mcl-1
Name:Induced myeloid leukemia cell differentiation protein Mcl-1
Synonyms:Bcl-2-like protein 3 | Bcl-2-like protein 3 (Mcl-1) | Bcl-2-related protein EAT/mcl1 | Bcl2-L-3 | Induced myeloid leukemia cell differentiation protein (Mcl-1) | Mcl-1 | Myeloid Cell factor-1 (Mcl-1) | Myeloid cell leukemia sequence 1 (BCL2-related) | mcl1/EAT
Type:Membrane; Single-pass membrane protein
Mol. Mass.:37332.87
Organism:Homo sapiens (Human)
Description:n/a
Residue:350
Sequence:
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50244151
n/a
NameBDBM50244151
Synonyms:CHEMBL4083870
TypeSmall organic molecule
Emp. Form.C39H39Cl2N5O4
Mol. Mass.712.664
SMILESCc1nn(C)c(C)c1-c1c(Cl)ccc2c(CCCOc3cc(C)c(Cl)c(C)c3)c3C(=O)N(CCCn3c12)c1cccc2c(cn(C)c12)C(O)=O |(47.37,-23.92,;45.91,-23.45,;45.43,-21.99,;43.89,-21.99,;42.98,-20.75,;43.41,-23.46,;41.95,-23.94,;44.66,-24.36,;44.67,-25.91,;43.34,-26.68,;42.01,-25.91,;43.34,-28.22,;44.68,-28.99,;46.01,-28.22,;47.48,-28.7,;47.96,-30.17,;49.47,-30.49,;49.94,-31.95,;51.45,-32.27,;51.93,-33.73,;53.43,-34.05,;53.91,-35.51,;55.41,-35.82,;52.87,-36.66,;53.35,-38.12,;51.37,-36.34,;50.34,-37.48,;50.89,-34.88,;48.39,-27.44,;49.95,-27.51,;50.56,-28.92,;50.97,-26.33,;50.68,-24.8,;49.31,-24.07,;47.89,-24.69,;47.48,-26.19,;46.01,-26.67,;52.46,-26.73,;53.53,-25.64,;55.02,-26.04,;55.42,-27.53,;54.33,-28.62,;54.4,-30.15,;52.97,-30.7,;52.01,-29.5,;50.51,-29.9,;52.84,-28.22,;55.7,-30.99,;57.07,-30.29,;55.61,-32.53,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: