Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInduced myeloid leukemia cell differentiation protein Mcl-1
LigandBDBM50244129
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1673167
Ki 1.3±n/a nM
Citation Shaw SBian ZZhao BTarr JCVeerasamy NJeon KOBelmar JArnold ALFogarty SAPerry ESensintaffar JLCamper DVRossanese OWLee TOlejniczak ETFesik SW Optimization of Potent and Selective Tricyclic Indole Diazepinone Myeloid Cell Leukemia-1 Inhibitors Using Structure-Based Design. J Med Chem 61:2410-2421 (2018) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Induced myeloid leukemia cell differentiation protein Mcl-1
Name:Induced myeloid leukemia cell differentiation protein Mcl-1
Synonyms:Bcl-2-like protein 3 | Bcl-2-like protein 3 (Mcl-1) | Bcl-2-related protein EAT/mcl1 | Bcl2-L-3 | Induced myeloid leukemia cell differentiation protein (Mcl-1) | Mcl-1 | Myeloid Cell factor-1 (Mcl-1) | Myeloid cell leukemia sequence 1 (BCL2-related) | mcl1/EAT
Type:Membrane; Single-pass membrane protein
Mol. Mass.:37332.87
Organism:Homo sapiens (Human)
Description:n/a
Residue:350
Sequence:
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50244129
n/a
NameBDBM50244129
Synonyms:CHEMBL4070674
TypeSmall organic molecule
Emp. Form.C35H35Cl2N5O4
Mol. Mass.660.59
SMILESCc1nn(C)c(C)c1-c1c(Cl)ccc2c(CCCOc3cc(C)c(Cl)c(C)c3)c3C(=O)N(CCCn3c12)c1cncc(c1)C(O)=O |(24.13,-44.36,;22.67,-43.89,;22.19,-42.43,;20.65,-42.43,;19.74,-41.19,;20.17,-43.9,;18.71,-44.38,;21.42,-44.8,;21.43,-46.35,;20.1,-47.12,;18.77,-46.35,;20.1,-48.66,;21.44,-49.43,;22.77,-48.66,;24.24,-49.14,;24.72,-50.61,;26.23,-50.93,;26.7,-52.39,;28.21,-52.71,;28.68,-54.17,;30.18,-54.49,;30.67,-55.95,;32.17,-56.26,;29.63,-57.1,;30.11,-58.56,;28.13,-56.78,;27.1,-57.92,;27.65,-55.32,;25.15,-47.88,;26.71,-47.95,;27.32,-49.36,;27.73,-46.77,;27.44,-45.24,;26.07,-44.51,;24.65,-45.13,;24.24,-46.63,;22.77,-47.11,;29.22,-47.17,;30.29,-46.08,;31.78,-46.48,;32.18,-47.97,;31.09,-49.06,;29.6,-48.66,;31.48,-50.55,;32.97,-50.95,;30.39,-51.63,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: