Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInduced myeloid leukemia cell differentiation protein Mcl-1
LigandBDBM50244173
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1673166
Ki 2.9±n/a nM
Citation Shaw SBian ZZhao BTarr JCVeerasamy NJeon KOBelmar JArnold ALFogarty SAPerry ESensintaffar JLCamper DVRossanese OWLee TOlejniczak ETFesik SW Optimization of Potent and Selective Tricyclic Indole Diazepinone Myeloid Cell Leukemia-1 Inhibitors Using Structure-Based Design. J Med Chem 61:2410-2421 (2018) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Induced myeloid leukemia cell differentiation protein Mcl-1
Name:Induced myeloid leukemia cell differentiation protein Mcl-1
Synonyms:Bcl-2-like protein 3 | Bcl-2-like protein 3 (Mcl-1) | Bcl-2-related protein EAT/mcl1 | Bcl2-L-3 | Induced myeloid leukemia cell differentiation protein (Mcl-1) | Mcl-1 | Myeloid Cell factor-1 (Mcl-1) | Myeloid cell leukemia sequence 1 (BCL2-related) | mcl1/EAT
Type:Membrane; Single-pass membrane protein
Mol. Mass.:37332.87
Organism:Homo sapiens (Human)
Description:n/a
Residue:350
Sequence:
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50244173
n/a
NameBDBM50244173
Synonyms:CHEMBL4064491
TypeSmall organic molecule
Emp. Form.C35H36Cl2N4O5
Mol. Mass.663.59
SMILESCc1nn(C)c(C)c1-c1c(Cl)ccc2c(CCCOc3cc(C)c(Cl)c(C)c3)c3C(=O)N(Cc4ccc(o4)C(O)=O)CCCn3c12 |(9.86,-24.76,;8.39,-24.29,;7.91,-22.83,;6.37,-22.83,;5.46,-21.59,;5.9,-24.3,;4.44,-24.78,;7.15,-25.2,;7.16,-26.75,;5.83,-27.52,;4.5,-26.75,;5.83,-29.06,;7.16,-29.83,;8.5,-29.06,;9.97,-29.54,;10.45,-31,;11.95,-31.32,;12.43,-32.79,;13.94,-33.11,;14.41,-34.57,;15.91,-34.89,;16.39,-36.34,;17.9,-36.66,;15.36,-37.5,;15.84,-38.96,;13.85,-37.18,;12.82,-38.32,;13.38,-35.71,;10.88,-28.28,;12.44,-28.35,;13.05,-29.76,;13.46,-27.17,;14.94,-27.57,;16.03,-26.48,;15.79,-24.96,;17.16,-24.26,;18.25,-25.35,;17.55,-26.73,;19.77,-25.12,;20.33,-23.68,;20.74,-26.31,;13.17,-25.64,;11.8,-24.91,;10.38,-25.53,;9.97,-27.03,;8.49,-27.51,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: