Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInduced myeloid leukemia cell differentiation protein Mcl-1
LigandBDBM50244169
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1673166
Ki 2.4±n/a nM
Citation Shaw SBian ZZhao BTarr JCVeerasamy NJeon KOBelmar JArnold ALFogarty SAPerry ESensintaffar JLCamper DVRossanese OWLee TOlejniczak ETFesik SW Optimization of Potent and Selective Tricyclic Indole Diazepinone Myeloid Cell Leukemia-1 Inhibitors Using Structure-Based Design. J Med Chem 61:2410-2421 (2018) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Induced myeloid leukemia cell differentiation protein Mcl-1
Name:Induced myeloid leukemia cell differentiation protein Mcl-1
Synonyms:Bcl-2-like protein 3 | Bcl-2-like protein 3 (Mcl-1) | Bcl-2-related protein EAT/mcl1 | Bcl2-L-3 | Induced myeloid leukemia cell differentiation protein (Mcl-1) | Mcl-1 | Myeloid Cell factor-1 (Mcl-1) | Myeloid cell leukemia sequence 1 (BCL2-related) | mcl1/EAT
Type:Membrane; Single-pass membrane protein
Mol. Mass.:37332.87
Organism:Homo sapiens (Human)
Description:n/a
Residue:350
Sequence:
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50244169
n/a
NameBDBM50244169
Synonyms:CHEMBL4091647
TypeSmall organic molecule
Emp. Form.C39H39Cl2N5O4
Mol. Mass.712.664
SMILESCc1nn(C)c(C)c1-c1c(Cl)ccc2c(CCCOc3cc(C)c(Cl)c(C)c3)c3C(=O)N(CCCn3c12)c1ccc(C(O)=O)c2ccn(C)c12 |(7.76,-23.42,;6.29,-22.95,;5.81,-21.48,;4.27,-21.49,;3.36,-20.24,;3.8,-22.95,;2.34,-23.43,;5.05,-23.85,;5.06,-25.4,;3.73,-26.17,;2.4,-25.4,;3.73,-27.72,;5.06,-28.49,;6.4,-27.72,;7.87,-28.2,;8.35,-29.66,;9.85,-29.98,;10.33,-31.44,;11.84,-31.76,;12.31,-33.23,;13.81,-33.54,;14.29,-35,;15.8,-35.31,;13.26,-36.15,;13.74,-37.62,;11.75,-35.83,;10.72,-36.98,;11.28,-34.37,;8.78,-26.94,;10.34,-27,;10.95,-28.42,;11.36,-25.82,;11.07,-24.29,;9.7,-23.56,;8.28,-24.18,;7.87,-25.69,;6.39,-26.16,;12.84,-26.23,;13.92,-25.14,;15.41,-25.53,;15.81,-27.03,;17.3,-27.43,;18.39,-26.34,;17.69,-28.91,;14.71,-28.11,;14.79,-29.64,;13.36,-30.19,;12.39,-29,;10.9,-29.39,;13.23,-27.71,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: