Reaction Details |
| Report a problem with these data |
Target | Cannabinoid receptor 2 |
---|
Ligand | BDBM50244270 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1673538 (CHEMBL4023567) |
---|
Ki | 4300±n/a nM |
---|
Citation | Dolles, D; Hoffmann, M; Gunesch, S; Marinelli, O; Möller, J; Santoni, G; Chatonnet, A; Lohse, MJ; Wittmann, HJ; Strasser, A; Nabissi, M; Maurice, T; Decker, M Structure-Activity Relationships and Computational Investigations into the Development of Potent and Balanced Dual-Acting Butyrylcholinesterase Inhibitors and Human Cannabinoid Receptor 2 Ligands with Pro-Cognitive in Vivo Profiles. J Med Chem61:1646-1663 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cannabinoid receptor 2 |
---|
Name: | Cannabinoid receptor 2 |
Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 39690.94 |
Organism: | Homo sapiens (Human) |
Description: | P34972 |
Residue: | 360 |
Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
BDBM50244270 |
---|
n/a |
---|
Name | BDBM50244270 |
Synonyms: | CHEMBL4099175 |
Type | Small organic molecule |
Emp. Form. | C28H31N3O2 |
Mol. Mass. | 441.5646 |
SMILES | CCOc1ccc(Cc2nc3cc(NC(=O)c4ccccc4)ccc3n2CCC(C)C)cc1 |
Structure |
|