Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase
LigandBDBM50163864
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1673911
Kd 5.1±n/a nM
Citation Linkuvien? VTalibov VODanielson UHMatulis D Introduction of Intrinsic Kinetics of Protein-Ligand Interactions and Their Implications for Drug Design. J Med Chem 61:2292-2302 (2018) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase
Name:Carbonic anhydrase
Synonyms:CA-XII | Carbonate dehydratase XII | Carbonic anhydrase 12 (CA XII) | Carbonic anhydrase XII (CA XII) | Carbonic anhydrase XII (CAXII) | Tumor antigen HOM-RCC-3.1.3
Type:Enzyme
Mol. Mass.:39456.00
Organism:Homo sapiens (Human)
Description:Catalytic domain of human cloned isozyme was used in the assay
Residue:354
Sequence:
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL
HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFN
PSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR
NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGL
SLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50163864
n/a
NameBDBM50163864
Synonyms:3-(1H-benzimidazol-1-ylacetyl)benzenesulfonamide (3a) | CHEMBL3799296 | carbonic anhydrase (CA) inhibitors, benzenesulphonamide ligand, 3
TypeSmall organic molecule
Emp. Form.C15H13N3O3S
Mol. Mass.315.347
SMILESNS(=O)(=O)c1cccc(c1)C(=O)Cn1cnc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: