Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 1
LigandBDBM50429899
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1673905
Kd 2.7±n/a nM
Citation Linkuvien? VTalibov VODanielson UHMatulis D Introduction of Intrinsic Kinetics of Protein-Ligand Interactions and Their Implications for Drug Design. J Med Chem 61:2292-2302 (2018) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 1
Name:Carbonic anhydrase 1
Synonyms:4.2.1.1 | CA-I | CA1 | Carbonate dehydratase I | Carbonic anhydrase 1 | Carbonic anhydrase I
Type:PROTEIN
Mol. Mass.:28941.00
Organism:Macaca mulatta
Description:ChEMBL_117334
Residue:261
Sequence:
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSEAKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSSNEYGSEHTVDGVKYSSELH
IVHWNSAKYSSLAEAVSKADGLAVIGVLMKVGEANPKLQKVLDALHAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYSGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGSNPV
PIQRNNRPTQPLKGRTVRASF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50429899
n/a
NameBDBM50429899
Synonyms:CHEMBL2333416
TypeSmall organic molecule
Emp. Form.C8H7F4NO3S2
Mol. Mass.305.27
SMILESNS(=O)(=O)c1c(F)c(F)c(SCCO)c(F)c1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: