Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein arginine N-methyltransferase 3
LigandBDBM50243294
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1676358
IC50 22±n/a nM
Citation Wang CJiang HJin JXie YChen ZZhang HLian FLiu YCZhang CDing HChen SZhang NZhang YJiang HChen KYe FYao ZLuo C Development of Potent Type I Protein Arginine Methyltransferase (PRMT) Inhibitors of Leukemia Cell Proliferation. J Med Chem 60:8888-8905 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein arginine N-methyltransferase 3
Name:Protein arginine N-methyltransferase 3
Synonyms:2.1.1.- | HRMT1L3 | Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3 | PRMT3 | Protein arginine N-methyltransferase 3
Type:PROTEIN
Mol. Mass.:59886.87
Organism:Homo sapiens
Description:ChEMBL_101368
Residue:531
Sequence:
MCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPCLFCNRLFTSA
EETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEY
LKPVLEDDLLLQFDVEDLYEPVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAR
EDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRT
ESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLN
KLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYP
DICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIK
HIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHW
KQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50243294
n/a
NameBDBM50243294
Synonyms:CHEMBL4094513
TypeSmall organic molecule
Emp. Form.C16H19ClN2S
Mol. Mass.306.853
SMILESCN(CCN)Cc1ccccc1Sc1ccccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: