Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPRMT5/MEP50 complex
LigandBDBM50243294
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1676360
IC50>100000±n/a nM
Citation Wang CJiang HJin JXie YChen ZZhang HLian FLiu YCZhang CDing HChen SZhang NZhang YJiang HChen KYe FYao ZLuo C Development of Potent Type I Protein Arginine Methyltransferase (PRMT) Inhibitors of Leukemia Cell Proliferation. J Med Chem 60:8888-8905 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
PRMT5/MEP50 complex
Name:PRMT5/MEP50 complex
Synonyms:72 kDa ICln-binding protein | HRMT1L5 | Histone-arginine N-methyltransferase PRMT5 | IBP72 | JBP1 | Jak-binding protein 1 | PRMT5 | PRMT5/MEP50 complex | Protein arginine N-methyltransferase 5 (PRMT5) | Protein arginine methyltransferase 5 (PRMT5) | SKB1 | SKB1 homolog | SKB1Hs | Shk1 kinase-binding protein 1 homolog
Type:Enzyme
Mol. Mass.:72679.99
Organism:Homo sapiens (Human)
Description:O14744
Residue:637
Sequence:
MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAK
NRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLP
AFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYS
GEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNK
KGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELF
AKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQV
LMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDM
REWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKL
YNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEF
PVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICV
RFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50243294
n/a
NameBDBM50243294
Synonyms:CHEMBL4094513
TypeSmall organic molecule
Emp. Form.C16H19ClN2S
Mol. Mass.306.853
SMILESCN(CCN)Cc1ccccc1Sc1ccccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: