Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM18512 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54414 (CHEMBL667172) |
---|
Kd | 16±n/a nM |
---|
Citation | Wagner, CR; Benkovic, SJ Probing the molecular basis of resistance to pyrimethamine by site-directed mutagenesis. J Med Chem35:2912-5 (1992) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | Dihydrofolate reductase (F31V) | dfrA17 |
Type: | n/a |
Mol. Mass.: | 17532.46 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 157 |
Sequence: | MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
|
|
|
BDBM18512 |
---|
n/a |
---|
Name | BDBM18512 |
Synonyms: | 5-(4-chlorophenyl)-6-ethylpyrimidine-2,4-diamine | CHEMBL36 | Pyrimethamine (Pyr) | US11530198, Example Pyrimethamine | cid_4993 |
Type | Small organic molecule |
Emp. Form. | C12H13ClN4 |
Mol. Mass. | 248.711 |
SMILES | CCc1nc(N)nc(N)c1-c1ccc(Cl)cc1 |
Structure |
|