| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Phospholipase A2, major isoenzyme |
|---|
| Ligand | BDBM50004504 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_156346 (CHEMBL759989) |
|---|
| IC50 | 1400±n/a nM |
|---|
| Citation |  Bennion, C; Connolly, S; Gensmantel, NP; Hallam, C; Jackson, CG; Primrose, WU; Roberts, GC; Robinson, DH; Slaich, PK Design and synthesis of some substrate analogue inhibitors of phospholipase A2 and investigations by NMR and molecular modeling into the binding interactions in the enzyme-inhibitor complex. J Med Chem35:2939-51 (1992) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Phospholipase A2, major isoenzyme |
|---|
| Name: | Phospholipase A2, major isoenzyme |
|---|
| Synonyms: | Group IB phospholipase A2 | PA21B_PIG | PLA2G1B | Phosphatidylcholine 2-acylhydrolase | Phospholipase A2 |
|---|
| Type: | Hydrolase; monomer or homodimer |
|---|
| Mol. Mass.: | 16279.83 |
|---|
| Organism: | Sus scrofa (pig) |
|---|
| Description: | Purchased from Sigma. |
|---|
| Residue: | 146 |
|---|
| Sequence: | MKFLVLAVLLTVGAAQEGISSRALWQFRSMIKCAIPGSHPLMDFNNYGCYCGLGGSGTPV
DELDRCCETHDNCYRDAKNLDSCKFLVDNPYTESYSYSCSNTEITCNSKNNACEAFICNC
DRNAAICFSKAPYNKEHKNLDTKKYC
|
|
|
|---|
| BDBM50004504 |
|---|
| n/a |
|---|
| Name | BDBM50004504 |
|---|
| Synonyms: | (R)-O-(2-Hexadecanamidopropyl] phosphocholine | CHEMBL102135 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H51N2O5P |
|---|
| Mol. Mass. | 478.6459 |
|---|
| SMILES | CCCCCCCCCCCCCCCC(=O)N[C@H](C)COP([O-])(=O)OCC[N+](C)(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
