Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor
LigandBDBM50004667
Substrate/Competitorn/a
Meas. Tech.ChEBML_138550
IC50 430.0±n/a nM
Citation Valli MJTang YKosh JWChapman JMSowell JW Synthesis and cholinergic properties of N-aryl-2-[[[5-[(dimethylamino)methyl]-2-furanyl]methyl]thio]ethylamino analogs of ranitidine. J Med Chem 35:3141-7 (1992) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor
Name:Muscarinic acetylcholine receptor
Synonyms:Cholinergic receptor, muscarinic 1, CNS | Cholinergic, muscarinic | Muscarinic acetylcholine receptor M1
Type:Enzyme Catalytic Domain
Mol. Mass.:51400.50
Organism:Mus musculus
Description:Cholinergic, muscarinic 0 0::Q52KQ0
Residue:460
Sequence:
MNTSVPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPESPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPKSSPNTVKRPTKKGRDRGGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTVNPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004667
n/a
NameBDBM50004667
Synonyms:CHEMBL320291 | N-[2-(5-Dimethylaminomethyl-furan-2-ylmethylsulfanyl)-ethyl]-N'-methyl-4,6-dinitro-benzene-1,3-diamine
TypeSmall organic molecule
Emp. Form.C17H23N5O5S
Mol. Mass.409.46
SMILESCNc1cc(NCCSCc2ccc(CN(C)C)o2)c(cc1[N+]([O-])=O)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: