new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1/Alpha-2A adrenergic receptor
LigandBDBM50247457
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1677776
EC50 140±n/a nM
Citation Petrelli RScortichini MBelardo CBoccella SLuongo LCapone FKachler SVita PDel Bello FMaione SLavecchia AKlotz KNCappellacci L Structure-Based Design, Synthesis, and In Vivo Antinociceptive Effects of Selective A J Med Chem 61:305-318 (2018) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A1/Alpha-2A adrenergic receptor
Name:Adenosine receptor A1/Alpha-2A adrenergic receptor
Synonyms:A1 adenosine receptor (hA1) | A1AR | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36520.92
Organism:Homo sapiens (Human)
Description:P30542
Residue:326
Sequence:
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50247457
n/a
NameBDBM50247457
Synonyms:CHEMBL4079464
TypeSmall organic molecule
Emp. Form.C14H18ClN5O4
Mol. Mass.355.777
SMILESO[C@@H]1[C@@H](CCl)O[C@H]([C@@H]1O)n1cnc2c(N[C@@H]3CCOC3)ncnc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: