new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNicotinamide N-methyltransferase (NNMT)
LigandBDBM50247635
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1678255
IC50 160000±n/a nM
Citation Babault NAllali-Hassani ALi FFan JYue AJu KLiu FVedadi MLiu JJin J Discovery of Bisubstrate Inhibitors of Nicotinamide N-Methyltransferase (NNMT). J Med Chem 61:1541-1551 (2018) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Nicotinamide N-methyltransferase (NNMT)
Name:Nicotinamide N-methyltransferase (NNMT)
Synonyms:NNMT | Nicotinamide N-methyltransferase
Type:Protein
Mol. Mass.:29571.16
Organism:Homo sapiens (Human)
Description:n/a
Residue:264
Sequence:
MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLI
DIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGN
RVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRAL
RNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQ
SYSSTMANNEGLFSLVARKLSRPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50247635
n/a
NameBDBM50247635
Synonyms:CHEMBL4100002
TypeSmall organic molecule
Emp. Form.C23H30N8O6
Mol. Mass.514.5343
SMILESN[C@@H](CCN(CCc1cccc(c1)C(N)=O)C[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(N)ncnc12)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: