| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Thymidylate synthase |
|---|
| Ligand | BDBM50005322 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_208947 |
|---|
| Ki | 39±n/a nM |
|---|
| Citation |  Reich, SH; Fuhry, MA; Nguyen, D; Pino, MJ; Welsh, KM; Webber, S; Janson, CA; Jordan, SR; Matthews, DA; Smith, WW Design and synthesis of novel 6,7-imidazotetrahydroquinoline inhibitors of thymidylate synthase using iterative protein crystal structure analysis. J Med Chem35:847-58 (1992) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Thymidylate synthase |
|---|
| Name: | Thymidylate synthase |
|---|
| Synonyms: | TS | TSase | Thymidylate Synthase (TS) | Thymidylate synthase | thyA |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 30487.86 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | n/a |
|---|
| Residue: | 264 |
|---|
| Sequence: | MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL
WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK
NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS
YALLVHMMAQQCDLEVGDFVWIGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF
DYRFEDFEIEGYDPHPGIKAPVAI
|
|
|
|---|
| BDBM50005322 |
|---|
| n/a |
|---|
| Name | BDBM50005322 |
|---|
| Synonyms: | CHEMBL353813 | [6-(2-Amino-1,6,7,8-tetrahydro-imidazo[4,5-g]quinolin-5-ylmethyl)-naphthalen-2-yl]-methanol |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H22N4O |
|---|
| Mol. Mass. | 358.4363 |
|---|
| SMILES | Nc1nc2cc3CCCN(Cc4ccc5cc(CO)ccc5c4)c3cc2[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
