Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-X-C chemokine receptor type 7 (CXCR7)
LigandBDBM50250391
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1681650
Ki 20±n/a nM
Citation Boehm MBeaumont KJones RKalgutkar ASZhang LAtkinson KBai GBrown JAEng HGoetz GHHolder BRKhunte BLazzaro SLimberakis CRyu SShapiro MJTylaska LYan JTurner RLeung SSFRamaseshan MPrice DALiras SJacobson MPEarp DJLokey RSMathiowetz AMMenhaji-Klotz E Discovery of Potent and Orally Bioavailable Macrocyclic Peptide-Peptoid Hybrid CXCR7 Modulators. J Med Chem 60:9653-9663 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-X-C chemokine receptor type 7 (CXCR7)
Name:C-X-C chemokine receptor type 7 (CXCR7)
Synonyms:C-X-C chemokine receptor type 7 | CMKOR1 | CXC-R7 | CXCR-7 | CXCR7 | Chemokine orphan receptor 1 | G-protein coupled receptor 159 | G-protein coupled receptor RDC1 homolog | GPR159 | RDC-1 | RDC1
Type:Enzyme
Mol. Mass.:41498.84
Organism:Homo sapiens (Human)
Description:P25106
Residue:362
Sequence:
MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMI
ANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVT
HLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDT
YYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAIS
ASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVT
QCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQS
TK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50250391
n/a
NameBDBM50250391
Synonyms:CHEMBL4064492
TypeSmall organic molecule
Emp. Form.C51H58N8O6S
Mol. Mass.911.121
SMILESCN1[C@@H](Cc2cscn2)C(=O)N[C@@H](Cc2cccnc2)C(=O)N2CCC[C@@H]2C(=O)N(CCCc2ccccc2)CC(=O)N[C@@H](CCCc2ccccc2)C(=O)N[C@H](Cc2ccccc2)C1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: