| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Ligand | BDBM50250606 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1681978 |
|---|
| Ki | 6200±n/a nM |
|---|
| Citation |  Witten, MR; Wissler, L; Snow, M; Geschwindner, S; Read, JA; Brandon, NJ; Nairn, AC; Lombroso, PJ; Käck, H; Ellman, JA X-ray Characterization and Structure-Based Optimization of Striatal-Enriched Protein Tyrosine Phosphatase Inhibitors. J Med Chem60:9299-9319 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Name: | Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Synonyms: | 3.1.3.2 | 3.1.3.48 | ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | PPAC_HUMAN | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 18042.81 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P24666 |
|---|
| Residue: | 158 |
|---|
| Sequence: | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
|
|
|
|---|
| BDBM50250606 |
|---|
| n/a |
|---|
| Name | BDBM50250606 |
|---|
| Synonyms: | CHEMBL4077342 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H21Cl3F2NO6PS |
|---|
| Mol. Mass. | 626.821 |
|---|
| SMILES | OP(O)(=O)C(F)(c1ccc(cc1)-c1cccc(Cc2cc(Cl)c(Cl)cc2Cl)c1F)S(=O)(=O)N1CCOCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
