| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50006984 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_201262 (CHEMBL804880) |
|---|
| IC50 | 13±n/a nM |
|---|
| Citation |  Wilson, AA; Dannals, RF; Ravert, HT; Sonders, MS; Weber, E; Wagner, HN Radiosynthesis of sigma receptor ligands for positron emission tomography: 11C- and 18F-labeled guanidines. J Med Chem34:1867-70 (1991) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50006984 |
|---|
| n/a |
|---|
| Name | BDBM50006984 |
|---|
| Synonyms: | CHEMBL413257 | N-Adamantan-1-yl-N'-(3-fluoro-phenyl)-guanidine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H22FN3 |
|---|
| Mol. Mass. | 287.3751 |
|---|
| SMILES | NC(Nc1cccc(F)c1)=NC12CC3CC(CC(C3)C1)C2 |w:10.11,TLB:14:15:19:13.12.18,THB:14:13:19:15.20.16,16:15:12:17.19.18,16:17:12:15.20.14| |
|---|
| Structure | 
|
|---|
Search and Browse
