Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM81924 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_201262 (CHEMBL804880) |
---|
IC50 | 76±n/a nM |
---|
Citation | Wilson, AA; Dannals, RF; Ravert, HT; Sonders, MS; Weber, E; Wagner, HN Radiosynthesis of sigma receptor ligands for positron emission tomography: 11C- and 18F-labeled guanidines. J Med Chem34:1867-70 (1991) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM81924 |
---|
n/a |
---|
Name | BDBM81924 |
Synonyms: | (R)-3-(1-Propyl-piperidin-3-yl)-phenol | 3PPP(+/-) | CAS_85976-54-1 | CHEMBL276500 | NSC_202477 | PPP, R(+)-3 | PPP, S(-)-3 |
Type | Small organic molecule |
Emp. Form. | C14H21NO |
Mol. Mass. | 219.3226 |
SMILES | CCCN1CCCC(C1)c1cccc(O)c1 |
Structure |
|