| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50007167 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_146256 |
|---|
| Ki | 420±n/a nM |
|---|
| Citation |  Vecchietti, V; Clarke, GD; Colle, R; Giardina, G; Petrone, G; Sbacchi, M (1S)-1-(aminomethyl)-2-(arylacetyl)-1,2,3,4-tetrahydroisoquinoline and heterocycle-condensed tetrahydropyridine derivatives: members of a novel class of very potent kappa opioid analgesics. J Med Chem34:2624-33 (1991) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50007167 |
|---|
| n/a |
|---|
| Name | BDBM50007167 |
|---|
| Synonyms: | 1-(4-Piperidin-1-ylmethyl-6,7-dihydro-4H-thieno[3,2-c]pyridin-5-yl)-2-(4-trifluoromethyl-phenyl)-ethanone;C4H6O6 | CHEMBL329114 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H25F3N2OS |
|---|
| Mol. Mass. | 422.507 |
|---|
| SMILES | FC(F)(F)c1ccc(CC(=O)N2CCc3sccc3C2CN2CCCCC2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
