Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50007159 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_146256 |
---|
Ki | 47±n/a nM |
---|
Citation | Vecchietti, V; Clarke, GD; Colle, R; Giardina, G; Petrone, G; Sbacchi, M (1S)-1-(aminomethyl)-2-(arylacetyl)-1,2,3,4-tetrahydroisoquinoline and heterocycle-condensed tetrahydropyridine derivatives: members of a novel class of very potent kappa opioid analgesics. J Med Chem34:2624-33 (1991) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50007159 |
---|
n/a |
---|
Name | BDBM50007159 |
Synonyms: | 2-(3,4-Dichloro-phenyl)-1-(4-pyrrolidin-1-ylmethyl-6,7-dihydro-4H-thieno[3,2-c]pyridin-5-yl)-ethanone;HCl | CHEMBL89307 |
Type | Small organic molecule |
Emp. Form. | C20H22Cl2N2OS |
Mol. Mass. | 409.372 |
SMILES | Clc1ccc(CC(=O)N2CCc3sccc3C2CN2CCCC2)cc1Cl |
Structure |
|