| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50254122 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1686073 (CHEMBL4036552) |
|---|
| Ki | 1.5±n/a nM |
|---|
| Citation |  Watanabe, Y; Hayashida, K; Saito, D; Takahashi, T; Sakai, J; Nakata, E; Kanda, T; Iwai, T; Hirayama, S; Fujii, H; Yamakawa, T; Nagase, H Design and synthesis of novel? opioid receptor agonists with an azatricyclodecane skeleton for improving blood-brain barrier penetration. Bioorg Med Chem Lett27:3495-3498 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50254122 |
|---|
| n/a |
|---|
| Name | BDBM50254122 |
|---|
| Synonyms: | CHEMBL4098662 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H42N2O |
|---|
| Mol. Mass. | 446.6673 |
|---|
| SMILES | [H][C@]12CN(CC3CCCCC3)C3CCC4(C1)C1Cc5ccc(O)cc5C4(CCN1CC1CC1)C23 |r,TLB:24:25:11.13.12:15.1,23:24:14:28.27.26,13:14:28.27.26:17.18.24,15:14:28.27.26:17.18.24,2:1:25:11.13.12,3:11:25:15.1,29:28:14:17.18.24,THB:19:18:14:28.27.26,26:25:11.13.12:15.1| |
|---|
| Structure | 
|
|---|
Search and Browse
