Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein kinase CLK1
LigandBDBM50259589
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1691310
IC50 23±n/a nM
Citation Bendjeddou LZLoaëc NVilliers BPrina ESpäth GFGalons HMeijer LOumata N Exploration of the imidazo[1,2-b]pyridazine scaffold as a protein kinase inhibitor. Eur J Med Chem 125:696-709 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificity protein kinase CLK1
Name:Dual specificity protein kinase CLK1
Synonyms:CDC-like kinase 1 | Protein kinase STY
Type:PROTEIN
Mol. Mass.:57124.52
Organism:Mus musculus
Description:ChEMBL_1502245
Residue:483
Sequence:
MRHSKRTYCPDWDERDWDYGTWRSSSSHKRKKRSHSSAREQKRCRYDHSKTTDSYYLESR
SINEKAYHSRRYVDEYRNDYMGYEPGHPYGEPGSRYQMHSSKSSGRSGRSSYKSKHRSRH
HTSQHHSHGKSHRRKRSRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECIDH
KVGGRRVAVKIVKNVDRYCEAAQSEIQVLEHLNTTDPHSTFRCVQMLEWFEHRGHICIVF
ELLGLSTYDFIKENSFLPFRMDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVKSDY
TEAYNPKMKRDERTIVNPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCD
VWSIGCILIEYYLGFTVFPTHDSREHLAMMERILGPLPKHMIQKTRKRRYFHHDRLDWDE
HSSAGRYVSRRCKPLKEFMLSQDAEHELLFDLIGKMLEYDPAKRITLKEALKHPFFYPLK
KHT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50259589
n/a
NameBDBM50259589
Synonyms:CHEMBL4065432
TypeSmall organic molecule
Emp. Form.C17H19N5O2
Mol. Mass.325.3651
SMILESCC[C@@H](CO)Nc1ccc2ncc(-c3cccc(\C=N\O)c3)n2n1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: