Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCysteinyl leukotriene receptor 1
LigandBDBM50291847
Substrate/Competitorn/a
Meas. Tech.ChEBML_52358
Ki 0.100000±n/a nM
Citation Huang FCGalemmo RAPoli GBLearn KSMorrissette MMJohnson WHDankulich WPCampbell HFCarnathan GWVanInwegen RG Development of a novel series of (2-quinolinylmethoxy)phenyl-containing compounds as high-affinity leukotriene D4 receptor antagonists. 4. Addition of chromone moiety enhances leukotriene D4 receptor binding affinity. J Med Chem 34:1704-7 (1991) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cysteinyl leukotriene receptor 1
Name:Cysteinyl leukotriene receptor 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:39007.58
Organism:GUINEA PIG
Description:Leukotriene D4 0 GUINEA PIG::Q2NNR5
Residue:340
Sequence:
MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSA
FQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAM
SFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPP
QDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIV
VTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFF
SGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50291847
n/a
NameBDBM50291847
Synonyms:7-[3-(Quinolin-2-ylmethoxy)-benzyloxy]-2-(1H-tetrazol-5-yl)-chroman-4-one | CHEMBL47430
TypeSmall organic molecule
Emp. Form.C27H21N5O4
Mol. Mass.479.4867
SMILESO=C1CC(Oc2cc(OCc3cccc(OCc4ccc5ccccc5n4)c3)ccc12)c1nnn[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: