| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50010548 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_146989 |
|---|
| IC50 | 6.6±n/a nM |
|---|
| Citation |  Yoshino, H; Nakazawa, T; Arakawa, Y; Kaneko, T; Tsuchiya, Y; Matsunaga, M; Araki, S; Ikeda, M; Yamatsu, K; Tachibana, S Synthesis and structure-activity relationships of dynorphin A-(1-8) amide analogues. J Med Chem33:206-12 (1990) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50010548 |
|---|
| n/a |
|---|
| Name | BDBM50010548 |
|---|
| Synonyms: | 2-[2-(2-{2-[3-(4-Hydroxy-phenyl)-2-methylamino-propionylamino]-acetylamino}-acetylamino)-3-phenyl-propionylamino]-4-methyl-pentanoic acid {4-guanidino-1-[4-guanidino-1-(1-hexylcarbamoyl-3-methyl-butylcarbamoyl)-butylcarbamoyl]-butyl}-amide | CHEMBL412769 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C53H87N15O9 |
|---|
| Mol. Mass. | 1078.353 |
|---|
| SMILES | CCCCCCNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](Cc1ccccc1)NC(=O)CNC(=O)CNC(=O)[C@H](Cc1ccc(O)cc1)NC |
|---|
| Structure | 
|
|---|
Search and Browse
