Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMu-type opioid receptor
LigandBDBM50010545
Substrate/Competitorn/a
Meas. Tech.ChEMBL_145148
Ki 1.7±n/a nM
Citation Yoshino HNakazawa TArakawa YKaneko TTsuchiya YMatsunaga MAraki SIkeda MYamatsu KTachibana S Synthesis and structure-activity relationships of dynorphin A-(1-8) amide analogues. J Med Chem 33:206-12 (1990) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Mu-type opioid receptor
Name:Mu-type opioid receptor
Synonyms:M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010545
n/a
NameBDBM50010545
Synonyms:2-{5-Guanidino-2-[(5-guanidino-2-{2-[2-(2-{2-[3-(4-hydroxy-phenyl)-2-methylamino-propionylamino]-acetylamino}-acetylamino)-3-(4-nitro-phenyl)-propionylamino]-4-methyl-pentanoylamino}-pentanoyl)-methyl-amino]-pentanoylamino}-4-methyl-pentanoic acidN-ethyl amide | CHEMBL415410
TypeSmall organic molecule
Emp. Form.C50H80N16O11
Mol. Mass.1081.2708
SMILESCCNC(=O)C(CC(C)C)NC(=O)C(CCC[N-]C(N)=[NH2+])N(C)C(=O)C(CCC[N-]C(N)=[NH2+])NC(=O)C(CC(C)C)NC(=O)C(Cc1ccc(cc1)[N+]([O-])=O)NC(=O)CNC(=O)CNC(=O)C(Cc1ccc(O)cc1)NC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: